PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00190g01523.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family HD-ZIP
Protein Properties Length: 306aa    MW: 34598.1 Da    PI: 6.1691
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00190g01523.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-18143197256
                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               rk+ ++tkeq  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Peaxi162Scf00190g01523.1 143 RKKLRLTKEQSIILEESFKEHSTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTK 197
                               678899***********************************************98 PP

2HD-ZIP_I/II125.32.8e-40143230188
               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                               +kk+rl+keq+ +LEesF+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+
  Peaxi162Scf00190g01523.1 143 RKKLRLTKEQSIILEESFKEHSTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTKMKQTEVDCEFLKRCVENLTEENRRLQKEVQ 227
                               69*********************************************************************************** PP

               HD-ZIP_I/II  86 eLr 88 
                               eLr
  Peaxi162Scf00190g01523.1 228 ELR 230
                               **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.3E-293113IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.607.0E-18125193IPR009057Homeodomain-like
SuperFamilySSF466891.17E-18133200IPR009057Homeodomain-like
PROSITE profilePS5007117.216139199IPR001356Homeobox domain
SMARTSM003891.4E-14141203IPR001356Homeobox domain
PfamPF000463.8E-16143197IPR001356Homeobox domain
CDDcd000862.85E-15143197No hitNo description
PRINTSPR000313.1E-5170179IPR000047Helix-turn-helix motif
PROSITE patternPS000270174197IPR017970Homeobox, conserved site
PRINTSPR000313.1E-5179195IPR000047Helix-turn-helix motif
CDDcd146860.00823190230No hitNo description
PfamPF021831.8E-10199232IPR003106Leucine zipper, homeobox-associated
SMARTSM003408.0E-24199242IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MMMVEKEDLG LSLSLSFAEN RTTNPMQLNL IPSLAPSTSH SPSAFNLIHK TSWTDSFPSS  60
PDRNSETCRA METRTFLKGI DVNWVADTEE EAGVSSPNST ISTVSGNKRN EREANEDNII  120
EMEMACSQGG IINSDEEDGE TCRKKLRLTK EQSIILEESF KEHSTLNPKQ KLALAKRLGL  180
RPRQVEVWFQ NRRARTKMKQ TEVDCEFLKR CVENLTEENR RLQKEVQELR GLERSPQFYM  240
QMTPPTTLTM CPSCERVASG PTNTPVNIGP HQLGPSQQQP MPFNLWATTP IPQGPLDSYP  300
LLGRQK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191199RRARTKMKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788263.11e-147PREDICTED: homeobox-leucine zipper protein HAT4-like
RefseqXP_016489981.11e-147PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466008e-94HAT1_ARATH; Homeobox-leucine zipper protein HAT1
TrEMBLK4C6R31e-137K4C6R3_SOLLC; Uncharacterized protein
STRINGSolyc06g060830.2.11e-137(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17460.15e-95Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein